DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG10232

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:282 Identity:60/282 - (21%)
Similarity:98/282 - (34%) Gaps:92/282 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVNGYPAPEGKAPYIVGLF-----IRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYV------ 88
            |:..|..|...:.|::..|.     :.|..:|.    :|::|...::||||||:..|.:      
  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNC----SGSLINKRYVLTAAHCVVKDKMVNTDLV 316

  Fly    89 --EIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQGG--------------------------RDI 125
              .:..|.:              :..::||....|.                          .||
  Fly   317 LRRVRLGEH--------------DITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDI 367

  Fly   126 GLIR--TP----HVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQII 184
            .|:|  ||    |......:.|.|:|..|..        ....|||...|...:..|       :
  Fly   368 ALVRLQTPVRYTHEILPICVPKDPIPLHNHP--------LQIAGWGYTKNREYSQVL-------L 417

  Fly   185 SNSECEQAY---GSVA----STDMCTRHADGKSVCGGDSGGPLVT------HDNARLVGVITFAS 236
            .|:..|..|   ..::    .:.:|.....|:..|.|||||||:.      .|...|.|::::.|
  Fly   418 HNTVYENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGS 482

  Fly   237 VSCHD-GPSGYTRVSDYLEWIR 257
            .:|.| .|..||:...:..||:
  Fly   483 ENCGDRKPGVYTKTGAFFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 58/279 (21%)
Tryp_SPc 36..259 CDD:238113 59/281 (21%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 59/278 (21%)
Tryp_SPc 260..503 CDD:214473 57/275 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435824
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.