DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG31199

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:260 Identity:51/260 - (19%)
Similarity:89/260 - (34%) Gaps:62/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCL-----TGDYVEIHYG- 93
            |||.| ...|||        ||.:|.      .|.:::...:|..|||.     ..:...:|.| 
  Fly    55 RIVYG-KGFEGK--------IRDNGC------LGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGV 104

  Fly    94 ------------SNWGWNGAYRQTVRRDNFISHPDWPSQGGRDIGLIRTPHVDFNGLINKIP--L 144
                        ...|:.....|.::......|||:.|:..::...:.|...|.....|.:|  :
  Fly   105 HNKSAPVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICM 169

  Fly   145 PSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQAYGSVASTDMCTRHADGK 209
            |..:..|:.......|..|....::..|..|     |..:|...|:....::.::        ..
  Fly   170 PPPSLLNETLVAQTFVVAGLRVFEDFRLKTW-----VNTLSRGFCQSKVKTLVTS--------SN 221

  Fly   210 SVCGGDS-------GGPLV-------THDNARLVGVITFASVSCHDGPSGYTRVSDYLEWIRDQT 260
            :|||...       |.|||       ...|..|||::.......:...|.:..:.:|:::||..:
  Fly   222 TVCGYHKQPVAYYLGAPLVGLQKKGHVTQNYYLVGIMIDWRWENNRIMSSFLAIRNYMDFIRQNS 286

  Fly   261  260
              Fly   287  286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 49/254 (19%)
Tryp_SPc 36..259 CDD:238113 50/256 (20%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 46/229 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.