DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG5255

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:286 Identity:80/286 - (27%)
Similarity:125/286 - (43%) Gaps:53/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTL----SAALALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSN 61
            |.|.||.|    |:|.:.:...|          |..:.|||.|..|..|.|||.:.|    .|..
  Fly     1 MLLILLPLVLFTSSAASQILYPP----------QYTKNRIVGGEEAAAGLAPYQISL----QGIG 51

  Fly    62 SGAVG-AGTIIANDWILTAAHC-----------LTGDYVEIHY-GSNWGWNGAYRQTVRRDNFIS 113
            |||.. .|.||...||:|||||           |||.. ::|. ||.:.:         .|..:.
  Fly    52 SGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQ-DLHQNGSKYYY---------PDRIVE 106

  Fly   114 HPDW-PSQGGRDIGLIRTPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMD-NGNLADWL 176
            |.:: |.:...||.|:   |::.:.:.:....|...:.......:..:..|||.:. .|::...|
  Fly   107 HSNYAPRKYRNDIALL---HLNESIVFDNATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARL 168

  Fly   177 QCVDVQIISNSECEQAYGSVASTD---MCTRHADGKSVCGGDSGGPLVTHDNARLVGVITFASVS 238
            |.::|..:...:|..|:.:....|   :||.:..|:..|.||||||||  .|.:||.::.: .:.
  Fly   169 QSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV--HNGKLVALVNW-GLP 230

  Fly   239 CHDG-PSGYTRVSDYLEWIRDQTGIS 263
            |..| |..:..:|.|.::||....:|
  Fly   231 CAKGYPDAHASISYYHDFIRTHLSLS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 68/239 (28%)
Tryp_SPc 36..259 CDD:238113 69/241 (29%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 68/239 (28%)
Tryp_SPc 30..252 CDD:238113 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436791
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.