DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG17475

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:281 Identity:78/281 - (27%)
Similarity:112/281 - (39%) Gaps:61/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LALVAASPTGLNRTTLLSQG-------AEG-----RIVNGYPAPEGKAPYIVGLFIRTDGSNSGA 64
            ||.....|....|...||:.       |||     |::||.....|:|.|.:.|    .|...|.
  Fly    14 LACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISL----QGMYGGH 74

  Fly    65 VGAGTIIANDWILTAAHCLTGDYVEIHYGSNWGWNGAYRQTVR--------------RDNFI--- 112
            :..|.||....:||||||:            :|:|..|.:.:.              .:::|   
  Fly    75 ICGGCIIDERHVLTAAHCV------------YGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCN 127

  Fly   113 -SHPDWPSQGGRDIGLIR-TPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDN-GNLAD 174
             :.||:.:    ||.||| ...:.||.......||:....|    .|..:..|||..:. |:..|
  Fly   128 YNSPDYHN----DIALIRLNDTIKFNEYTQPAELPTAPVAN----GTQLLLTGWGSTELWGDTPD 184

  Fly   175 WLQCVDVQIISNSECEQAYGSVAST---DMCTRHADGKSVCGGDSGGPLVTHDNARLVGVITFAS 236
            .||...:..:..|.|::...:..|.   .:||....|:..|.||||||| || |..|.|::.:..
  Fly   185 ILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPL-TH-NGVLYGLVNWGY 247

  Fly   237 VSCHDGPSGYTRVSDYLEWIR 257
            ......|..:..|..||||||
  Fly   248 PCALGVPDSHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 66/243 (27%)
Tryp_SPc 36..259 CDD:238113 68/245 (28%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 66/243 (27%)
Tryp_SPc 50..269 CDD:238113 68/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436792
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.