DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG31326

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:271 Identity:70/271 - (25%)
Similarity:112/271 - (41%) Gaps:45/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PTGLNR--TTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAH 81
            |.|..|  ||.|       |..|.....|:.|::|.:|.|.:.:....:..||:|:...:|:|||
  Fly   262 PCGRERASTTPL-------IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAH 319

  Fly    82 C-------LTGDYVEIHYGSNW---GWNGAYR---QTVRRDNFISHPDWPSQGGRDIGLIRTPH- 132
            |       |....:.:..|.|.   ..:|.:|   |.:..:||    .:......|:.|:|... 
  Fly   320 CFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENF----QFKQFTEADLALVRLDEP 380

  Fly   133 VDFNGLINKIPLPSMNEQNDRYQDTWCVACGWG----GMDNGNLADWLQCVDVQIISNSEC--EQ 191
            |.:...|..|.|.|.:.:.|..|.......|||    |..|..::   :..|:.|:|.:.|  |.
  Fly   381 VRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVS---KVTDLNIVSEANCALEL 442

  Fly   192 AYGSVASTDMCTRHADGKSVCGGDSGGPLVTHDNARLV-------GVITFASVSCH-DGPSGYTR 248
            .:..|..:.:|.:.. |...|..|.||||:..:....|       |||.....:|. ..||.:|.
  Fly   443 PHVLVQPSSLCAKKT-GAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTD 506

  Fly   249 VSDYLEWIRDQ 259
            |:.::||:|.:
  Fly   507 VAKHIEWVRQK 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 62/248 (25%)
Tryp_SPc 36..259 CDD:238113 64/250 (26%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 63/247 (26%)
Tryp_SPc 277..514 CDD:214473 61/244 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.