DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG13318

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:292 Identity:71/292 - (24%)
Similarity:110/292 - (37%) Gaps:65/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLSAALALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKA------------PYIVGLFIRTDG 59
            ||:.:..|||....|..:.        ||   .:|.|.|..            |:...|....| 
  Fly   133 TLTCSYGLVACCQAGSYQC--------GR---RFPPPPGSTTAAPGQASFGAYPWQAALLTTAD- 185

  Fly    60 SNSGAVGAGTIIANDWILTAAHCLTG---DYVEIHYGSNWGWNGAY------RQTVRRDNFISHP 115
               ..:|.|.:|....:|||||.:..   .|.::..|.   |:.|.      .|.|...|...:|
  Fly   186 ---VYLGGGALITAQHVLTAAHKVYNLGLTYFKVRLGE---WDAASTSEPIPAQDVYISNVYVNP 244

  Fly   116 DW-PSQGGRDIGLIR--TP-HVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLADWL 176
            .: |:....|:.:::  || .:.....:..:.||:.:....|     |...|||..|.|....:.
  Fly   245 SFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPTTSFVGQR-----CWVAGWGKNDFGATGAYQ 304

  Fly   177 ---QCVDVQIISNSECEQAYGSV---------ASTDMCTRHADGKSVCGGDSGGPLVTHDNA--R 227
               :.|||.:|.|:.|:.|..:.         .::.:|.....||..|.||.|.|||...|.  .
  Fly   305 AIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTSNGVWY 369

  Fly   228 LVGVITFASVSCHDG--PSGYTRVSDYLEWIR 257
            :||::.: .:.|...  |..|..|..||.||:
  Fly   370 VVGLVAW-GIGCAQAGVPGVYVNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 62/261 (24%)
Tryp_SPc 36..259 CDD:238113 63/263 (24%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 60/245 (24%)
Tryp_SPc 169..399 CDD:214473 58/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.