DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG14088

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:240 Identity:57/240 - (23%)
Similarity:88/240 - (36%) Gaps:54/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGSNWGWNGAYRQTVRR 108
            :|.:|.|||.:..........||.||:|...:|||..||  ||.:.: ..:..|..|.....:..
  Fly    36 DGLSPDIVGPWTAILHHFGRIVGVGTLIHERFILTDVHC--GDSIGV-IRARLGEYGRIGSELAE 97

  Fly   109 DN----FISHPDW-PSQGGRDIG---LIRT----PHVDFNGLINKIPL-PSMNEQNDRYQD---- 156
            |:    |.|:.:: |.....::|   |:||    .|:        ||: ..|:.:...:.|    
  Fly    98 DHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKEHI--------IPVCILMDSRMQTFADELDY 154

  Fly   157 ----TWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQAYGSVASTDMCTRHADGKSVCGGDSG 217
                ||         .|.:.:..|:...|     ....||.|.:.....|..|.|..| |...||
  Fly   155 FNGTTW---------KNSDKSPMLRSKTV-----IRMPQACGKLDHGQFCAGHKDLDS-CDEPSG 204

  Fly   218 GPL------VTHDNARLVGVITFASVSCHDGPSGYTRVSDYLEWI 256
            ..|      :..:...|.|:.....|.|.:..: ||.|....:||
  Fly   205 AALTREIDYIGPNRTVLFGIANSVEVKCSNSRT-YTDVVQLHQWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 55/238 (23%)
Tryp_SPc 36..259 CDD:238113 57/240 (24%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 55/234 (24%)
Tryp_SPc 42..248 CDD:214473 53/232 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.