DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG18223

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:312 Identity:72/312 - (23%)
Similarity:108/312 - (34%) Gaps:106/312 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLLTLSAALALVAASPTGLN----RTTLLSQ---GAEGRIVNGYPAPEGKAPYIVGLFIRTD-- 58
            ||||.|...|.  |..|.|.:    |...||.   ..|..:|        .|.|:|.:..|..  
  Fly    17 LFLLLLLPILD--AGDPIGSHFVRRRAKRLSSPYFDKEKTLV--------LAKYVVSIRSRRPHK 71

  Fly    59 --GSNSGAVGAGTIIANDWILTAAHCLTGDYVEIH------------------------------ 91
              |.|...  .|.||:..:|||:|||.......:|                              
  Fly    72 LFGDNHFC--GGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKI 134

  Fly    92 --------YGSNWGWNGAYRQTVRR---DNFISHPDWPSQGGRDIGLIRTPHVDFNGLINKIPLP 145
                    :.:|   |.|.....::   ||.:            :|:|..|..|        |.|
  Fly   135 FVPDKFTVFNTN---NIALMMLAKKLPLDNPL------------VGVINLPTAD--------PEP 176

  Fly   146 SMNEQNDRYQDTWCVACGWGGM-DNGNLADWLQCVDVQIISNSECEQAYGSVASTDMCTRHADG- 208
            .:|          ....|||.: ..|.||..:..:||:::....||:.........||..:.:. 
  Fly   177 GLN----------YTVLGWGRIFKGGPLASDILHIDVELLPRDICEKKVHIFKEEMMCAGNLNNT 231

  Fly   209 --KSVCGGDSGGPLVTHDNARLVGVITFASVSCHDG--PSGYTRVSDYLEWI 256
              ::.|.||:|.||:.  |..:.||::: .|.|...  ||.||.|..:::||
  Fly   232 MDENPCAGDTGSPLIF--NETVFGVVSY-RVGCGSKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 57/271 (21%)
Tryp_SPc 36..259 CDD:238113 59/272 (22%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 57/259 (22%)
Tryp_SPc 60..280 CDD:214473 55/257 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436789
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.