DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:274 Identity:136/274 - (49%)
Similarity:174/274 - (63%) Gaps:23/274 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSAALALVAASPTGLNR------TTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDG 59
            ||.|:..|  |||:.:||...:.|      |.:.::..:|||.|||||.||||||.|||     |
  Fly     1 MKAFIAIL--ALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGL-----G 58

  Fly    60 SNSGAVGAGTIIANDWILTAAHCL-TGDYVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQGGR 123
            .:.|....|:|||:||:|||.||: ..|.|.:::|:.|..|..:...|...|||.|      ...
  Fly    59 FSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKH------SSA 117

  Fly   124 DIGLIRTPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGN-LADWLQCVDVQIISNS 187
            ||.|||.|||||..::||:.|||.|::.:.|.:.|.|||||||..:|: |.|:|||||:|||.||
  Fly   118 DIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNS 182

  Fly   188 ECEQAYGSVASTDMCTRHADGKSVCGGDSGGPLVTHDNARLVGVITFASVS-CHDG-PSGYTRVS 250
            ||...||||....:|.|..||||.|||||||||||||..:||||..|.||: |..| |:|:.||:
  Fly   183 ECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVT 247

  Fly   251 DYLEWIRDQTGISY 264
            .:|:||||.|||:|
  Fly   248 YHLDWIRDHTGIAY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 116/224 (52%)
Tryp_SPc 36..259 CDD:238113 118/226 (52%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 116/224 (52%)
Tryp_SPc 40..256 CDD:238113 118/226 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.