DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG10472

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:281 Identity:97/281 - (34%)
Similarity:141/281 - (50%) Gaps:25/281 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLLTLSAALALVAASPTGLNRTTLLSQG-----AEGRIVNGYPAPEGKAPYIVGLFIRTDGSNS 62
            |.|.|:..|.|:...|...||..|.:.:.     ..|||..|..|...:.||.|||.:...|  .
  Fly     9 LLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITG--G 71

  Fly    63 GAVGAGTIIANDWILTAAHC----LTGDYVEIHYGSNWGWN----GAYRQTVRRDNFISHPDWPS 119
            .|...||||::.||:|||||    .||  |:::.|::...|    |.....|...|.|.|.||.:
  Fly    72 AAWCGGTIISDRWIITAAHCTDSLTTG--VDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIA 134

  Fly   120 QG-GRDIGLIRTP-HVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNG--NLADWLQCVD 180
            :. ..||.||:.| .::||..|....||..::....|.....:|.|||.:.:.  ...|.||...
  Fly   135 ETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYAT 199

  Fly   181 VQIISNSECEQAY-GSVASTDMCTRHADGKSVCGGDSGGPLVTHDNAR-LVGVITFA-SVSCHDG 242
            |.|::||.|...| |.||::::|.:...|.|.|.||||||||..|.:. |:|..:|. ::.|..|
  Fly   200 VPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIALGCEVG 264

  Fly   243 -PSGYTRVSDYLEWIRDQTGI 262
             |..:||::.||:||.:::|:
  Fly   265 WPGVFTRITYYLDWIEEKSGV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 84/236 (36%)
Tryp_SPc 36..259 CDD:238113 85/238 (36%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 84/236 (36%)
Tryp_SPc 47..282 CDD:238113 85/238 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470899
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.