DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG15873

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:279 Identity:69/279 - (24%)
Similarity:120/279 - (43%) Gaps:38/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFL-LTLSAALALVAASPTGLNRTTLLSQGAEGRIVNGY-PAPEGKAPYIVGL----FIRTDG 59
            :.:|| |.||.:|:.......|    .:..:..|..|..|| |.....:.::|.:    ::|..|
  Fly     4 LTVFLGLILSTSLSDADLGVIG----DISDETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRG 64

  Fly    60 SNSGAVGAGTIIANDWILTAAHCLTGDY--------VEIHYGSNWGWNGAYRQTVRR--DNFISH 114
            .|...  :|.::::..:||||||||..|        :.:.:| :......|.::..|  |..:.|
  Fly    65 DNHFC--SGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFG-HITRLAVYDESDFRSVDRLVVH 126

  Fly   115 PDWPSQGGRDIGLIRTPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGM-DNGNLADWLQC 178
            |::......|:.::|......:...:.:||......|..|.|| |:..|||.: .:|..::.|..
  Fly   127 PEYERYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDT-CITLGWGQIYQHGPYSNELVY 190

  Fly   179 VDVQIISNSECEQAYGS-VASTDMCTRHADGKSVCGGDSGGPLVTHDNARLVGVITFASVSCHDG 242
            :||.:...|.|::.|.: .|..::||........|.||.||||:..      |.: |..:..|.|
  Fly   191 LDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCK------GAL-FGLIGGHMG 248

  Fly   243 PSG-----YTRVSDYLEWI 256
            .:|     :.....|.:||
  Fly   249 CAGGKAMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 59/242 (24%)
Tryp_SPc 36..259 CDD:238113 61/243 (25%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 57/224 (25%)
Tryp_SPc 59..250 CDD:238113 52/201 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.