DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG12133

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:257 Identity:65/257 - (25%)
Similarity:104/257 - (40%) Gaps:35/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IVNGYPAPEGKAPY--IVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCL-TGDY--VEIHYGSN 95
            ||.|..|...:.|:  ::|....|.......:.||::||:.::||||||| ..|:  ..:..|.:
  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEH 126

  Fly    96 ---------WGWNGA-----YRQTVRRDNFISHPDWPSQGGR---DIGLIR-TPHVDFNGLINKI 142
                     |..|||     ....:..|..:.|..:.::.||   ||.|:| ...|.:...|..|
  Fly   127 DTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPI 191

  Fly   143 PL-PSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQAYGSV---ASTDMCT 203
            .: |.:......:::......|||.......:..|:...:..:|..||...|.::   ....:|.
  Fly   192 CIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKDIQICA 256

  Fly   204 RHADGKSVCGGDSGGPLVTHDNA------RLVGVITFAS--VSCHDGPSGYTRVSDYLEWIR 257
            ...||.....||||.||:.....      .|.|:.::..  .|...||:.||:.|.|.|||:
  Fly   257 MGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 63/254 (25%)
Tryp_SPc 36..259 CDD:238113 65/257 (25%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 65/257 (25%)
Tryp_SPc 62..317 CDD:214473 63/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.