DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and scaf

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:225 Identity:57/225 - (25%)
Similarity:82/225 - (36%) Gaps:57/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SNSGAVGAGTIIANDWILTAAHCLTGDYV--------EIHYGSN-----WGWNGAYRQTVRRDNF 111
            |:...:..|.||.:.::|::|.|:.|..|        |...||.     :...|.....|     
  Fly   444 SSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKTVDV----- 503

  Fly   112 ISHPDW-PSQGGRDIGLIRTP-HVDFNGLINKIPL----PSMNEQNDRYQDTWCVACGWGGM--- 167
              |||: ||....|:.:||.. .::|...|..|.:    |..:||        |...|||..   
  Fly   504 --HPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQ--------CFTSGWGKQALS 558

  Fly   168 --DNGNLADWLQCVDVQIISNSECEQAYGSVAST---DMCTRHADGKSVCGGDSGGPLVTHDNAR 227
              :.|.|   :...|....:.|||.....||.|.   |.|.........||..|        :.|
  Fly   559 IHEEGAL---MHVTDTLPQARSECSADSSSVCSATKFDSCQFDVGSALACGSGS--------SVR 612

  Fly   228 LVGVITFASV-SCHDGPSGYTRVSDYLEWI 256
            |.|:  ||.. ||.:|.:......| ::||
  Fly   613 LKGI--FAGENSCGEGQTVRFAKPD-IKWI 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 55/223 (25%)
Tryp_SPc 36..259 CDD:238113 57/225 (25%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 48/197 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.