DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG17572

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:289 Identity:75/289 - (25%)
Similarity:114/289 - (39%) Gaps:48/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SAALALVAASPTGLNRTTLLSQG-AEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVG---AGT 69
            |..|..|....:.|.:..:..:. .:|....|.    |..|::..:..:  ..|:||..   ||.
  Fly   105 SEELPYVCCPSSPLEKNQVCGKSLVQGHFYKGL----GSYPFVARIGFK--HVNTGAFAYPCAGA 163

  Fly    70 IIANDWILTAAHCL-------------TGDYVEIHYG--SNWGWNGAYRQTVRRDNFISHPDW-P 118
            :||...|||||||.             .|:|......  :|.|:...........:.|.|||: .
  Fly   164 VIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQ 228

  Fly   119 SQGGRDIGL--IRTPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLAD-WLQCVD 180
            .|...||.|  ::||   .|..:...|:.....:.:..........|||.|...::.. .:..:|
  Fly   229 GQYHHDIALLVLKTP---LNYSVATQPICLQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLD 290

  Fly   181 VQIISNSECEQAYGSVASTD---------MCTRHADGKSVCGGDSGGPLVTHDNA--RLVGVITF 234
            |.:.|...|.:.|||..:.:         ||. ..:||.||.|..|.||...:|.  ..:|:::|
  Fly   291 VPLTSWDLCLRNYGSTGALESPNSIEGQWMCA-GGEGKDVCQGFGGAPLFIQENGIFSQIGIMSF 354

  Fly   235 ASVSCHDG---PSGYTRVSDYLEWIRDQT 260
            .|.:| .|   ||.||.|:.:.|||.|.|
  Fly   355 GSDNC-GGLRIPSVYTSVAHFSEWIHDNT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 66/256 (26%)
Tryp_SPc 36..259 CDD:238113 68/258 (26%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 67/249 (27%)
Tryp_SPc 138..378 CDD:214473 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.