DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG4650

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:277 Identity:66/277 - (23%)
Similarity:112/277 - (40%) Gaps:40/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSAALALVAASPTGLNRTTLLSQGAEGR---IVNGYPAPEGKAPYIVGLFIRTDGSNS 62
            |...::.:||.|.|:....:        ||..:||   :.||..|....:|::.  ::.|  |..
  Fly     1 MDSVVIGISALLFLLPVPGS--------SQYLDGRCGLLTNGKIANNISSPWMA--YLHT--SEL 53

  Fly    63 GAVGAGTIIANDWILTAAHCL-TGDYVEIHYGSNWGWNGA-------YRQTVRRDNFISHPDWPS 119
            ..|..||:|....:||||||. ..:.:....|...|.:.|       |:.:   ..||......:
  Fly    54 LYVCGGTVITEKLVLTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVS---QTFIHSLYNTT 115

  Fly   120 QGGRDIGLI-RTPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACG--WGGMDNGNLADWLQCVDV 181
            ....||.:: ....:.|:..|..|.:....... :|.|...|..|  ||..::.|.:|..:..|:
  Fly   116 TSANDIAILGLATDIVFSKTIRPICIVWWTIWR-KYIDNIQVLSGAQWGLPNDRNESDAFRITDI 179

  Fly   182 QIISNSECEQAYG-SVASTDMCTRHADGKSVCGGDSGGPL---VTHDNAR---LVGVITFASVSC 239
            :....:.|....| ::.|:..|...:|.| :|..|...||   :|..|.:   |:|:.| .:..|
  Fly   180 RRQPANMCSTLNGTAILSSQFCAGDSDSK-LCNVDFSSPLGAIITFKNIQRYVLIGIAT-TNQKC 242

  Fly   240 HDGPSGYTRVSDYLEWI 256
            ... |.||.|..:.::|
  Fly   243 KRA-SVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 57/241 (24%)
Tryp_SPc 36..259 CDD:238113 57/239 (24%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 56/235 (24%)
Tryp_SPc 33..258 CDD:304450 56/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.