DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG9377

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:269 Identity:61/269 - (22%)
Similarity:102/269 - (37%) Gaps:81/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GYPAPE---GKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTG---DYVEIHYGSNWG 97
            ||...|   |:.|::|.::    ||:: .:.:|.:|....::|.|||:..   :.|.:..|.   
  Fly   101 GYKQQEAKFGEFPWLVAVY----GSDT-YLCSGALITPLAVITTAHCVQNSEMEKVRLLAGE--- 157

  Fly    98 WNGA---------YRQTVRRDNFISHPDWPSQG-GRDIGLIRTPHVDFNGLINK----------- 141
            |:.|         .|..|..   :.||::.... ..:|.::         |::|           
  Fly   158 WDAAVELEPQPHQQRSVVET---LVHPNYTQMPLAHNIAIL---------LVDKEKPFQLAPNVQ 210

  Fly   142 ---IPLPSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQAYGSVASTDMCT 203
               :|.|.:     .|..:.|...||...|.|..|...:...:.::...:|..   .:..:.:..
  Fly   211 PICLPPPRI-----MYNYSQCYVSGWQRSDFGRAAILPKRWTLYVLPPDQCRT---KLRLSLLGR 267

  Fly   204 RHADGKSV--CGGDSGG---------------PLVTHDNA-RLVGVITFASVSCHDGPS--G-YT 247
            |||...|:  .|||.|.               ||..||:. .|.|::| .:..| |||.  | ||
  Fly   268 RHAHNDSLLCAGGDKGDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLT-RTARC-DGPQLLGIYT 330

  Fly   248 RVSDYLEWI 256
            .|..|.:||
  Fly   331 NVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 59/267 (22%)
Tryp_SPc 36..259 CDD:238113 61/269 (23%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 59/265 (22%)
Tryp_SPc 105..339 CDD:214473 57/263 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.