DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and PRSS48

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:278 Identity:74/278 - (26%)
Similarity:113/278 - (40%) Gaps:48/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLLTLSAALALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAG 68
            |.::|| :|:||...|.           ...|:|.|..|..|:.|:.|.|..     :...:..|
Human    31 FHISLS-SLSLVCGQPV-----------YSSRVVGGQDAAAGRWPWQVSLHF-----DHNFICGG 78

  Fly    69 TIIANDWILTAAHCLTGDYVEIHYGSNWGWNGAY-----RQTVRR--DNFISHPDWPSQGGRDIG 126
            ::::...|||||||:...:....|..   |.|:.     |:.|:.  ...:.||.:..... |:.
Human    79 SLVSERLILTAAHCIQPTWTTFSYTV---WLGSITVGDSRKRVKYYVSKIVIHPKYQDTTA-DVA 139

  Fly   127 LIR-TPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLADW---LQCVDVQIISNS 187
            |:: :..|.|...|..|.|||:.:|  .....:|...|||.:...:..|:   ||..:|.||...
Human   140 LLKLSSQVTFTSAILPICLPSVTKQ--LAIPPFCWVTGWGKVKESSDRDYHSALQEAEVPIIDRQ 202

  Fly   188 ECEQAYGSVA-----------STDMCTRHADG-KSVCGGDSGGPLVTHDNARLV--GVITFASVS 238
            .|||.|..:.           ...:|...... |..|.|||||||..|.:...:  ||:::....
Human   203 ACEQLYNPIGIFLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGVWIQTGVVSWGLEC 267

  Fly   239 CHDGPSGYTRVSDYLEWI 256
            ....|..||.|..|.:||
Human   268 GKSLPGVYTNVIYYQKWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 65/245 (27%)
Tryp_SPc 36..259 CDD:238113 66/246 (27%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 65/245 (27%)
Tryp_SPc 51..288 CDD:238113 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.