DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and psh

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:247 Identity:66/247 - (26%)
Similarity:106/247 - (42%) Gaps:32/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGD-----YVEIHYGSN 95
            ||.|||...|..|::..:...|.|::...  .|::||:.::||||||:..|     :|.:...:.
  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRC--GGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNI 206

  Fly    96 WGWNGAYRQTVRRDNFISHPDWPSQGGRDIGLIRTPHVDFNGLINKIPLPSMNEQNDRYQDTWCV 160
            ...:.:|:..|.|...| ||.:......||.::.... |.....|..|.....:..|...::...
  Fly   207 ENPDHSYQDIVIRSVKI-HPQYVGNKYNDIAILELER-DVVETDNIRPACLHTDATDPPSNSKFF 269

  Fly   161 ACGWGGMDNGNLA--DWLQCVDVQIISNSECEQAY----GS-------VASTDMCTRHADGKSV- 211
            ..|||.::....|  ..|....::::...:|..:|    ||       |..:.:|.  .|.|.: 
  Fly   270 VAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCA--IDQKLIA 332

  Fly   212 --CGGDSGGPLVTHDNAR-----LVGVITFASVSCHDGPSGYTRVSDYLEWI 256
              |.|||||||:...|..     ::|||:.........|..|||||.||::|
  Fly   333 DACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 65/245 (27%)
Tryp_SPc 36..259 CDD:238113 66/247 (27%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 65/245 (27%)
Tryp_SPc 144..387 CDD:238113 66/247 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436985
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.