DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and sphe

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:256 Identity:60/256 - (23%)
Similarity:107/256 - (41%) Gaps:25/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWI 76
            |.|:..:..|:..       |:|||:.|..|......:...|  |.|.::   |..|:|::...|
  Fly     9 LGLIGLTAVGMCH-------AQGRIMGGEDADATATTFTASL--RVDNAH---VCGGSILSQTKI 61

  Fly    77 LTAAHCLTGD-------YVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQGGRDIGLIRTPHVD 134
            ||.|||:..|       .:....||...:.|.  :.|..::...|||:.:.......:..:..:.
  Fly    62 LTTAHCVHRDGKLIDASRLACRVGSTNQYAGG--KIVNVESVAVHPDYYNLNNNLAVITLSSELT 124

  Fly   135 FNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQAYGSVAST 199
            :...|..|||.:..|.... :.:..:..|||...:|..:..::.:.:::...:.|..||......
  Fly   125 YTDRITAIPLVASGEALPA-EGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQ 188

  Fly   200 DMCTRHADGKSVCGGDSGGPLVTHDNARLVGVITFASVSCHDG-PSGYTRVSDYLEWIRDQ 259
            ..|..|...:..|.||.||..: :.|. |:|:..|...:|... |..:.|:|.|.:||::|
  Fly   189 SFCLAHELKEGTCHGDGGGGAI-YGNT-LIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 52/228 (23%)
Tryp_SPc 36..259 CDD:238113 53/230 (23%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 50/214 (23%)
Tryp_SPc 42..244 CDD:214473 48/211 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.