DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG31220

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:319 Identity:76/319 - (23%)
Similarity:119/319 - (37%) Gaps:100/319 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLFLLTLSAALALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVG 66
            ::::.....|..|.:....|..:||       .|::.|......:.|::..|..|    |..|..
  Fly    77 RIYICCPKPANTLPSYPDCGKPQTT-------NRVIGGTEPNLNEYPWLAMLLYR----NRSAFN 130

  Fly    67 ---------AGTIIANDWILTAAHCLTGDYVEIHYGSNWGWNGAYRQTVR-RDNFISH-PDWPSQ 120
                     .|::|...::||||||:|...::|             |.|| .::..|| ||..|:
  Fly   131 PDRELVPSCGGSLINTRYVLTAAHCVTDTVLQI-------------QRVRLGEHTTSHNPDCISR 182

  Fly   121 GGRDIGLIRTP-HVDFNGLINKIPLPSMNEQND---------------------RYQDTWCVAC- 162
            |.|   ::..| |:|       |.:.|:...||                     ||...:...| 
  Fly   183 GAR---IVCAPTHLD-------IDVESITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICV 237

  Fly   163 ---------------GWG--GM-DNGNLADWLQCVDVQIISNSECEQAYGS---VASTDMCTRHA 206
                           |||  || |.|:..  |:...|::....||.:.|..   .....:|....
  Fly   238 LDYPRSLMKFKMYVAGWGKTGMFDTGSKV--LKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGL 300

  Fly   207 DGKSVCGGDSGGPLVTHDNARLVGVITF-ASVSCHDGPSG-------YTRVSDYLEWIR 257
            |.:..|.||||.||: ..:.|....||| |.::.:.||.|       :||.:.:.:|||
  Fly   301 DNRGTCDGDSGSPLM-GTSGRSYETITFLAGITSYGGPCGTIGWPSVFTRTAKFYKWIR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 68/283 (24%)
Tryp_SPc 36..259 CDD:238113 70/285 (25%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 68/283 (24%)
Tryp_SPc 104..360 CDD:238113 70/285 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435821
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.