DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG31269

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:290 Identity:77/290 - (26%)
Similarity:115/290 - (39%) Gaps:72/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSAALALVAASPTGLNRTTLL---SQGAEG------RIVNGYPAPEGKAPYIVGLFIRTDGSNSG 63
            :||.:.|:....:||...|.:   ....:|      ||:.|..|.:|.|||.:.|        .|
  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISL--------QG 57

  Fly    64 AVGA----GTIIANDWILTAAHCLTGDYVE---IHYGSNWGWNGAYRQTVRR------------D 109
            ..||    |.||...::||||||:...::.   :..|:|     .|.|...|            |
  Fly    58 ISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTN-----KYNQPGGRYFLKAIHIHCNYD 117

  Fly   110 NFISHPDWPSQGGRDIGLIR-TPHVDFNGLINKIPLPSMNEQ-NDRYQDTWCVACGWGGMDNGNL 172
            |...|        .||.|:. ...:.::.....||||.:..| .|.     .:..||     |:.
  Fly   118 NPEMH--------NDIALLELVEPIAWDERTQPIPLPLVPMQPGDE-----VILTGW-----GST 164

  Fly   173 ADW------LQCVDVQIISNSECEQAYGSVASTD---MCTRHADGKSVCGGDSGGPLVTHDNARL 228
            ..|      ||.:.:|.:.:.||:....:....|   :||....|:..|.||||||||:  |..|
  Fly   165 VLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVS--NGYL 227

  Fly   229 VGVITFASVSCHDGPSGYTRVSDYLEWIRD 258
            ||::.:........|..:..|..|.:|||:
  Fly   228 VGLVNWGWPCATGVPDVHASVYFYRDWIRN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 67/250 (27%)
Tryp_SPc 36..259 CDD:238113 69/253 (27%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 67/250 (27%)
Tryp_SPc 38..258 CDD:238113 69/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.