DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG31205

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:282 Identity:66/282 - (23%)
Similarity:113/282 - (40%) Gaps:53/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLLTLSAALALVAASPTG----------LNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLF-IRT 57
            ||||::.....:.|:..|          .|...::::..|             .|::|.:. :..
  Fly     9 FLLTITTLHPTIQAASVGQECGIFNEKQYNSDNIIAEPTE-------------HPWVVRIVGVTK 60

  Fly    58 DGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGSNWGWNGAYRQTVRRDNFIS----HPDW- 117
            ||||: .:..|.:|.:..::|||||::.|..|..||..:|.:.:     ...|.:|    |||: 
  Fly    61 DGSNT-LLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDS-----SNINLVSAVTVHPDYS 119

  Fly   118 PSQGGRDIGLIR-TPHVDFNGLINKIPLPSMNEQ--NDRYQDTWCVACGWGGMDNGNLADWLQCV 179
            |.:...|:.:|. |..|.|:.|:..|.|||::|.  .....::..:..|..|..........|.:
  Fly   120 PRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRL 184

  Fly   180 DVQI------ISNSECEQAYGSVASTDMCTRHADGKSVCGG----DSGGPLVTHDNARLVGVITF 234
            |.:|      |.:.||.:.........:| .|.:...:.|.    .||.|...|    |:|:...
  Fly   185 DKRIKMTYTKIDSKECHEKQARFPEELIC-GHTERSPLSGSALTEASGTPRQFH----LLGIAVA 244

  Fly   235 ASVSCHDGPSGYTRVSDYLEWI 256
            ...|......||..:..:|:||
  Fly   245 GFFSSDLDHQGYLNIRPHLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 56/239 (23%)
Tryp_SPc 36..259 CDD:238113 58/240 (24%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 36/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.