DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and sphinx1

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:267 Identity:80/267 - (29%)
Similarity:136/267 - (50%) Gaps:17/267 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSAALALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAV 65
            |||.:..|..:|.:.......|:          .||..||.|......|:||:......::|...
  Fly     1 MKLVVTLLVLSLTVSVGEKNKLS----------PRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNY 55

  Fly    66 GAGTIIANDWILTAAHCLTGDYVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQGGRDIGLIRT 130
            ||||||:|.||||....|...|:|:|..|...:.|.....:.::||..|.|    ....|.|::.
  Fly    56 GAGTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFHYD----NDHVIALVKC 116

  Fly   131 PHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWG-GMDNGNLADWLQCVDVQIISNSECEQAYG 194
            |:..|:..::::.:|:.:.:.:||.....:.||:| ...:..|.:|::|::|::::|:||.:.|.
  Fly   117 PYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAKYYT 181

  Fly   195 SVASTDMCTRHADGKSVCGGDSGGPLVT-HDNARLVGVITFASVSCHDG-PSGYTRVSDYLEWIR 257
            .:...:|||.....|.||.||.||.:|| ..|...:|:|.....:|..| ||.:.||||:::||:
  Fly   182 PLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGIIWLMPENCSIGYPSVHIRVSDHIKWIK 246

  Fly   258 DQTGISY 264
            ..:|:.:
  Fly   247 RVSGVGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 71/223 (32%)
Tryp_SPc 36..259 CDD:238113 72/225 (32%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 71/223 (32%)
Tryp_SPc 26..248 CDD:304450 72/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470962
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0R
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.