DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG11664

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:226 Identity:51/226 - (22%)
Similarity:94/226 - (41%) Gaps:36/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCL----TGDYVEIHYGSNW-GW 98
            |.|..:....|::.::      ....:.||::.:..::||.|||.    ..:.:.:..|..| .|
  Fly    26 GIPVQQQNYGYVMQIY------GPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAW 84

  Fly    99 NGAYRQTVRRDNFISHPDW-PSQGGRDIGLIRT------PH-VDFNGLINKIPLPSMNEQNDRYQ 155
            ....:|..   ..:.||.: |.....||.::|.      .| :::.||.:: ||..:|......:
  Fly    85 EFRGKQVA---GLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSR-PLTPLNMFAPPQE 145

  Fly   156 DTWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQAYGSVASTDMCTRHADGKSVCGGDSGGPL 220
                 ..||..|   ::|..|:.:.||:.....|.|.:..::...:|.....|:.:|.||||.||
  Fly   146 -----LAGWNLM---HIAQPLKSMSVQVEPEKNCRQWFPQISGGVICASATMGEGLCYGDSGDPL 202

  Fly   221 VTHDNARLVGVITFASVSCHDG--PSGYTRV 249
            ::  ...:.| :..|...|.|.  |:.:|.|
  Fly   203 IS--GGEVCG-LAIAFRKCGDKRYPALFTDV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 51/226 (23%)
Tryp_SPc 36..259 CDD:238113 51/226 (23%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 48/214 (22%)
Tryp_SPc 38..237 CDD:214473 48/214 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.