DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and Mcpt2

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:271 Identity:69/271 - (25%)
Similarity:114/271 - (42%) Gaps:53/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLLTLSAALALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGA 67
            |||:    ||.|    |:|        .||| .|:.|..:.....||:..|.|.|: .....:..
  Rat     5 LFLM----ALLL----PSG--------AGAE-EIIGGVESIPHSRPYMAHLDIVTE-KGLRVICG 51

  Fly    68 GTIIANDWILTAAHCLTGDYVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQGG-RDIGLIR-T 130
            |.:|:..::||||||...:...|....:.....:.:|.::.:..|.|..:.|... .||.|:: .
  Rat    52 GFLISRQFVLTAAHCKGREITVILGAHDVRKRESTQQKIKVEKQIIHESYNSVPNLHDIMLLKLE 116

  Fly   131 PHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLADW-LQCVDVQIISNSEC----- 189
            ..|:....:|.:||||.::  ..:....|.|.|||.....:...: |:.|:::|:....|     
  Rat   117 KKVELTPAVNVVPLPSPSD--FIHPGAMCWAAGWGKTGVRDPTSYTLREVELRIMDEKACVDYRY 179

  Fly   190 -----EQAYGSVASTDMCTRHADGKSVCGGDSGGPL----VTHDNARLVGVITFASVSCHDGPSG 245
                 :...||..:.         ::...|||||||    |.|      |::::....... |:.
  Rat   180 YEYKFQVCVGSPTTL---------RAAFMGDSGGPLLCAGVAH------GIVSYGHPDAKP-PAI 228

  Fly   246 YTRVSDYLEWI 256
            :||||.|:.||
  Rat   229 FTRVSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 56/237 (24%)
Tryp_SPc 36..259 CDD:238113 58/238 (24%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 56/237 (24%)
Tryp_SPc 21..242 CDD:238113 58/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.