DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG18420

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:290 Identity:76/290 - (26%)
Similarity:127/290 - (43%) Gaps:58/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSAALALVAASPTGLNRTTLLSQ--GAEG------RIVNGYPAPEGKAPYIVGLFIRT 57
            |::.::.:::.|.|:...|. |..|..|..  |...      |||||..|....:|::.  |:.|
  Fly     1 MEIVVIGMASILLLLTVFPL-LGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMA--FLHT 62

  Fly    58 DGSNSGAVGAGTIIANDWILTAAHCL---------TGDYVEIHYGSNWGWNGAYRQTVRRDNFIS 113
              |::..:..||:|:...:||||||.         .|:|       |....| ||:..:.:....
  Fly    63 --SSNQFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEY-------NRKLKG-YREEHQVNRTFQ 117

  Fly   114 HPDW-PSQGGRDIGLIR-TPHVDFNGLINKIPLPSMNEQNDRYQDTW---------CVACGWGGM 167
            |..: |:....||.|:| ..:|.:...|..|.:        .:..:|         ....|||..
  Fly   118 HRFYDPNTHANDIALLRLVSNVVYKANIRPICI--------MWDASWKHHIDSIKVLTGTGWGRT 174

  Fly   168 DNGNLADWLQCVDVQIISNSECEQAYGSVASTDMCTRHADGKSVCGGDSGGP---LVTHDNA-RL 228
            ::.:.:..|:.:|:....:..|  |:|||.|...|..:.: .::|.||:|||   :|.:.|| |.
  Fly   175 ESMHDSSELRTLDISRQPSKMC--AFGSVLSNQFCAGNWN-SNLCIGDTGGPVGAMVRYRNAFRF 236

  Fly   229 VGV-ITFASVSCHDGPSGYTRVSDYLEWIR 257
            |.| |...:..| ..||.:|.|..::|:||
  Fly   237 VQVGIAITNKRC-QRPSVFTDVMSHIEFIR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 66/245 (27%)
Tryp_SPc 36..259 CDD:238113 67/247 (27%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 66/245 (27%)
Tryp_SPc 43..267 CDD:238113 67/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.