DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG18636

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:249 Identity:65/249 - (26%)
Similarity:107/249 - (42%) Gaps:41/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCL---------TGDYVEI 90
            ||:||:.|....:|::|.|...||....|    |::|.:..:||||||.         .|:|...
  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCG----GSLITDKLVLTAAHCFIANQHLVARLGEYERT 104

  Fly    91 HYGSNWGWNGAYRQTVRRDNFISHPDW-PSQGGRDIGLIR-TPHVDFNGLINKIPLPSMNEQNDR 153
            ......|:...:|:....|....|..: |:....||.::| :..|.:...|..|.:.        
  Fly   105 RSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVV-------- 161

  Fly   154 YQDTW---------CVACGWGGMDNGNLADWLQCVDVQIISNSECEQAYG-SVASTDMCTRHADG 208
            :...|         ..|.|||.....:.:|.||.:|::......|.:..| ::|....|..:.| 
  Fly   162 WDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWD- 225

  Fly   209 KSVCGGDSGGPL---VTHDNAR---LVGVITFASVSCHDGPSGYTRVSDYLEWI 256
            .::|.|||||||   :||.|.:   .||:.::.:.:|... |.:|.|..:.|:|
  Fly   226 SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA-SVFTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 64/247 (26%)
Tryp_SPc 36..259 CDD:238113 64/248 (26%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/247 (26%)
Tryp_SPc 45..278 CDD:238113 63/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.