DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG33461

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:315 Identity:78/315 - (24%)
Similarity:122/315 - (38%) Gaps:99/315 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLLTLSAALALVAASPTGLNRTTLLSQGA------EGRIVNGYPAPEGKAPYIVGLFIRTDGSN 61
            |.:.|:.|.|||......| :.:..|.:..      ..:|:||.||..|:.|::.  |:.|.   
  Fly     4 LEMKTIIAYLALFVLGVHG-SSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMA--FLHTP--- 62

  Fly    62 SGAVGAGTIIANDW-ILTAAHCLTGDYVEI--HYGSNWGWNGAYRQTVRRDNFI----------- 112
            :..:.||::| |.| :||:|||:..| ||:  ..|.|           .|||.|           
  Fly    63 TYFLCAGSLI-NQWFVLTSAHCIEDD-VELIARLGEN-----------NRDNDIDCENNRCLEAT 114

  Fly   113 ---------SHPDW-PSQGGRDIGLIR-------TPHVDFNGLINKIPLPSMNEQNDRY---QDT 157
                     .|..: |.....|||::|       |.|:.        |:...:.:..:.   |.|
  Fly   115 QEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQ--------PICIFHHRRMQLVVDQIT 171

  Fly   158 WCVACGWGGMDNGNLADWLQCVDVQIISN-------------SECEQAY-GSVASTDMCTRHADG 208
            |..|.|||          |...|:...|:             ::|.:.: .:..|..:|..:.||
  Fly   172 WFKATGWG----------LTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDG 226

  Fly   209 KSVCGGDSGGP----LVTHDNARLV--GVITFASVSCHDGPSGYTRVSDYLEWIR 257
             ::|.||||||    ::.....|.|  |:.:|...:| ...|..|.|..|..||:
  Fly   227 -NLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENC-SKVSILTDVVRYGRWIK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 68/274 (25%)
Tryp_SPc 36..259 CDD:238113 70/276 (25%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 68/274 (25%)
Tryp_SPc 42..281 CDD:238113 70/276 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.