DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and PRSS33

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:280 Identity:80/280 - (28%)
Similarity:117/280 - (41%) Gaps:39/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGA-VGAGTIIANDW 75
            |.|.||...|.............|||.|....:|:.|:...:      .:.|| |..|::||..|
Human    13 LVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASI------QHRGAHVCGGSLIAPQW 71

  Fly    76 ILTAAHC-----LTGDYVEIHYGS-NWGWNGAYRQTVRRDNFISHPDWPSQGGR-DIGL--IRTP 131
            :||||||     |..:| .:..|: ..|.......:|.....:..||:...|.| |:.|  :|.|
Human    72 VLTAAHCFPRRALPAEY-RVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRP 135

  Fly   132 HVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNG-NLADW--LQCVDVQIISNSECE--- 190
             |..:..:..:.||....:..  ..|.|...|||.:..| .|.:|  ||.|.|.::.:..|:   
Human   136 -VPLSARVQPVCLPVPGARPP--PGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGLY 197

  Fly   191 -------QAYGSVASTDMCTRHADG-KSVCGGDSGGPLVTHDNAR--LVGVITFA-SVSCHDGPS 244
                   ||...|....:|..:..| |..|.|||||||....:..  ||||:::. ..:..:.|.
Human   198 HVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPG 262

  Fly   245 GYTRVSDYLEWIRDQTGISY 264
            .||.|:.|..||  |..:|:
Human   263 VYTSVATYSPWI--QARVSF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 71/247 (29%)
Tryp_SPc 36..259 CDD:238113 72/249 (29%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 72/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.