DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG30323

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:328 Identity:63/328 - (19%)
Similarity:95/328 - (28%) Gaps:124/328 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSAALALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTD------G 59
            |:..||.|..:.|.......||.|...::......:|:                |||.      |
  Fly     1 MQFLLLLLLTSSAYSNEGKKGLQRNLYVTDNYHQNVVS----------------IRTRKHIRHWG 49

  Fly    60 SNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQGGRD 124
            .|...  ||::::..|::|:..|:                     :.|.:   |.|:.||.....
  Fly    50 DNHFC--AGSLLSAWWVVTSGCCV---------------------STRPE---STPNQPSNRKNL 88

  Fly   125 IGLIRTP------------HVDFNGLINKIPLP------------------------SMNEQNDR 153
            ..::.||            ||      .||.|.                        :|......
  Fly    89 RVVVFTPKRLKKPSPKNIYHV------QKIVLDESAISGCTELALLKLDRGVTGQRFAMMLPEKE 147

  Fly   154 YQDTW-CVACGWG-----------------GMDNGNLADWLQ---------CVDVQIISNSECEQ 191
            ...|| |.:.|||                 .|...|...|.|         .:..|.||..||:.
  Fly   148 LNSTWLCNSLGWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKP 212

  Fly   192 AYGSVASTDMCTRHADGK-SVCGGDSGGPLVTHDNARLVGVITFASVSCHDGPSGYTRVSDYLEW 255
            .    .|..:|.....|: ::|..|.|.||..  :..|.||.........:|...||.:....::
  Fly   213 D----CSRCLCMTSYTGRGNMCQQDLGSPLFC--DHFLYGVARRVHTCDDEGFMFYTNIYQNRKF 271

  Fly   256 IRD 258
            |.|
  Fly   272 IED 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 53/290 (18%)
Tryp_SPc 36..259 CDD:238113 55/293 (19%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 51/268 (19%)
Tryp_SPc 45..272 CDD:214473 49/264 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471249
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.