DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG30187

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:242 Identity:66/242 - (27%)
Similarity:102/242 - (42%) Gaps:34/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTG-DYVEIHYGSNWGW 98
            :|..|:.|....:.::..:..||.     .:..||:|...::||||||:.. |...:..      
  Fly    35 KITGGHNAAFQNSVWMAAVHNRTH-----FICGGTLIHKRFVLTAAHCIVDQDVQSVSL------ 88

  Fly    99 NGAYRQT---VRRD--NFISHPDWPSQGG--RDIGLIR-TPHVDFNGLINK--IPLPSMNEQNDR 153
             |||.::   .|:|  ..:.|..:..:..  .||||:: :..|.||.||..  |.|......:.|
  Fly    89 -GAYNKSDPADRKDVITAVVHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLNKSMANHMR 152

  Fly   154 YQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQAYGSVASTDMCTRHADGKSVCGGDSGG 218
            ...|: .|.|||.:.....:|.||.:.:..:...||........|.............|||||||
  Fly   153 NMRTF-KAFGWGTLRGNKTSDILQTIILNHLDREECYMELSVYPSEKQICAGVPSGDTCGGDSGG 216

  Fly   219 PLVTHD-------NARL-VGVITFASVSCHDGPSGYTRVSDYLEWIR 257
            || |:|       |..: .|:|:....|| ||...||.:..:.:||:
  Fly   217 PL-TNDVFIQGIGNREVQFGIISVGKTSC-DGQGVYTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 64/239 (27%)
Tryp_SPc 36..259 CDD:238113 66/241 (27%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 64/239 (27%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.