DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG30088

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:262 Identity:69/262 - (26%)
Similarity:107/262 - (40%) Gaps:71/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGSNWGWN 99
            |||.|..|....||::..|:..:: .:.|    ||||::.:|||||||:. .|:::..|.:    
  Fly    44 RIVRGKEAMLKSAPFMAYLYYSSE-IHCG----GTIISSRYILTAAHCMR-PYLKVRLGEH---- 98

  Fly   100 GAYRQTVRRDNFISHPDWPSQGG-------------------------RDIGLIR-TPHVDFNG- 137
                      :...:||  .|||                         .||.|:: :.::.||. 
  Fly    99 ----------DITRNPD--CQGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLKLSRNIRFNVH 151

  Fly   138 ------LINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQAYGSV 196
                  ::|....|:::|    :|     |.|||..:..:.|:.||...:....|..|.......
  Fly   152 IQPICLILNPAAAPNVHE----FQ-----AFGWGQTETNHSANVLQTTVLTRYDNRHCRSVLSMP 207

  Fly   197 ASTDMCTRHADGKSVCGGDSGGPLVTHDNARLV------GVITFASVSCHDGPSGYTRVSDYLEW 255
            .:.:.......|...|.|||||||||..|...|      |:::|....| ..|..||.|.:|:.|
  Fly   208 ITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKC-QSPGVYTYVPNYIRW 271

  Fly   256 IR 257
            ||
  Fly   272 IR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 66/259 (25%)
Tryp_SPc 36..259 CDD:238113 68/261 (26%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 66/259 (25%)
Tryp_SPc 45..273 CDD:238113 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435841
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.