DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG30083

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:240 Identity:71/240 - (29%)
Similarity:112/240 - (46%) Gaps:35/240 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEI-----HYGS 94
            :|::|..|..|..|::..:|...|...:..|..||:|...::|:||||:..|.:..     |..|
  Fly    33 KIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSS 97

  Fly    95 NWGWNGAYRQTVRRDNFISHPDWPSQGGRDIGLIR-TPHVDFNGLINKI-----PLPSMNEQNDR 153
            .:   .|..:..|...|.:     .....|||::| .|.|.||.:|..|     |....|.:..:
  Fly    98 RY---FAVTKAFRNKYFTT-----GSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFK 154

  Fly   154 YQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSEC-EQAYGSVASTDMCTRHADGKSVCGGDSG 217
                   |.|||..:|...:..|:.|::..::.||| ...:.:|..:.:|..|.|| ..|.||||
  Fly   155 -------AAGWGKTENETFSKVLKTVELNELNASECYNMLWVNVTESQICAGHPDG-DTCAGDSG 211

  Fly   218 GPLV----THDNARLV--GVITFASVSCHDGPSGYTRVSDYLEWI 256
            |||:    ...:.|.|  |:|:|.|..| :.|..|||:|.:::||
  Fly   212 GPLIHPVYMDGSLRYVQLGIISFGSSLC-NSPGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 69/238 (29%)
Tryp_SPc 36..259 CDD:238113 71/239 (30%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 69/238 (29%)
Tryp_SPc 34..255 CDD:238113 69/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.