DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG30082

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:304 Identity:83/304 - (27%)
Similarity:116/304 - (38%) Gaps:94/304 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLLTLSAALALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAG 68
            ||:.|:..|......|   |..|.::.....|||.|..|..|..|::..|.     .||..|..|
  Fly    11 FLVCLTPKLRAQFIDP---NCGTTINLPPTNRIVGGRTADIGSNPWLAYLH-----KNSSLVCTG 67

  Fly    69 TIIANDWILTAAHCLTGDY---VEIHYGSNWGWNGAYRQTVRRD----------------NFISH 114
            |:|...::|||||||...:   |.:         |.|..:.|.|                |...|
  Fly    68 TLITKRFVLTAAHCLHSFHLLTVRL---------GEYDTSTRIDCTSEFCIPTYEEYSVENAYIH 123

  Fly   115 PDWPSQGGR-----DIGLIRTPHVDFNGLI---------------NKIPLPSMNEQNDRYQDTWC 159
            ..:   |||     ||||::     .||.:               .::|..|..|          
  Fly   124 TFF---GGRQDSRNDIGLLK-----LNGTVVYKLFIRPICLFRDPGQVPYSSTYE---------- 170

  Fly   160 VACGWGGMDNGNLADWLQCVDVQIISNSECEQ------AYGSVASTDMCTRHADGKSVCGGDSGG 218
             |.|||.:|..|.|..||.|::..:..|:||:      :||...:...   .||   .|.|||||
  Fly   171 -AAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQFCAGQW---RAD---TCSGDSGG 228

  Fly   219 PLVTH-DNARL-----VGVITFASVSCHDGPSGYTRVSDYLEWI 256
            ||... .|.|:     :|::::....|. ||..||.|..:..||
  Fly   229 PLSRKMSNGRITRTVQLGIVSYGHYLCR-GPGVYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 74/271 (27%)
Tryp_SPc 36..259 CDD:238113 75/272 (28%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 74/271 (27%)
Tryp_SPc 40..274 CDD:238113 75/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.