DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and Klk1b3

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:280 Identity:74/280 - (26%)
Similarity:121/280 - (43%) Gaps:49/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLLTLSAALAL---VAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGA 64
            ::.|.|..||:|   .||.|            .:.|:|.||.......|:.|.::...:     .
  Rat     5 MWFLILFLALSLGRNDAAPP------------VQSRVVGGYNCEMNSQPWQVAVYYFGE-----Y 52

  Fly    65 VGAGTIIANDWILTAAHCLTGDYVEIHYGSNW-GWNGAYRQTVRRDNFISHPDWPSQG-GRDI-- 125
            :..|.:|...|::|||||.|.:|      ..| |.|..|.......:.:....:|..| .:|:  
  Rat    53 LCGGVLIDPSWVITAAHCATDNY------QVWLGRNNLYEDEPFAQHRLVSQSFPHPGFNQDLIW 111

  Fly   126 GLIRTPHVDFNGLINKIPLPSMNEQNDRYQ-----------DTWCVACGWGGM--DNGNLADWLQ 177
            ...|.|..|::..:..:.|....:..|..:           .:.|:|.|||.:  |...|:|.||
  Rat   112 NHTRQPGDDYSNDLMLLHLSQPADITDGVKVIDLPIEEPKVGSTCLASGWGSITPDGLELSDDLQ 176

  Fly   178 CVDVQIISNSECEQAY-GSVASTDMCTRHAD-GKSVCGGDSGGPLVTHDNARLVGVITFASVSCH 240
            ||::.::||.:|.:|: ..|....:|....| ||..|.|||||||:.  |..|.|:.::....|.
  Rat   177 CVNIDLLSNEKCVEAHKEEVTDLMLCAGEMDGGKDTCKGDSGGPLIC--NGVLQGITSWGFNPCG 239

  Fly   241 D--GPSGYTRVSDYLEWIRD 258
            :  .|..||::..:..||::
  Rat   240 EPKKPGIYTKLIKFTPWIKE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 64/241 (27%)
Tryp_SPc 36..259 CDD:238113 65/244 (27%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 64/241 (27%)
Tryp_SPc 29..260 CDD:238113 65/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.