DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and Prss27

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_780649.1 Gene:Prss27 / 213171 MGIID:2450123 Length:328 Species:Mus musculus


Alignment Length:274 Identity:78/274 - (28%)
Similarity:111/274 - (40%) Gaps:57/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LLSQGAEG--------------RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWIL 77
            ||..|.||              |:|.|..|.||:.|:.|.  |:.:|.:   ...|::||..|:|
Mouse    15 LLRSGTEGARTLRACGHPKMFNRMVGGENALEGEWPWQVS--IQRNGIH---FCGGSLIAPTWVL 74

  Fly    78 TAAHCL--TGD---YVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQG---GRDIGLIRTP-HV 133
            |||||.  |.|   |..:.........|.:...|......|:|.:  ||   ..|:.|:... .|
Mouse    75 TAAHCFSNTSDISIYQVLLGALKLQQPGPHALYVPVKQVKSNPQY--QGMASSADVALVELQGPV 137

  Fly   134 DFNGLINKIPLPSMNEQNDRYQDTWCVACGWGG------MDNGNLADWLQCVDVQIISNSECEQA 192
            .|...|..:.||..:...:...:.|  ..|||.      :.|..:   ||.:.|.||...:|...
Mouse   138 TFTNYILPVCLPDPSVIFESGMNCW--VTGWGSPSEQDRLPNPRV---LQKLAVPIIDTPKCNLL 197

  Fly   193 YGSVASTD----------MCTRHADG-KSVCGGDSGGPLVTHDNARLV--GVITFASVSC--HDG 242
            |.....:|          :|...|:| |..|.||||||||...:...|  |||::.. .|  .:.
Mouse   198 YNKDVESDFQLKTIKDDMLCAGFAEGKKDACKGDSGGPLVCLVDQSWVQAGVISWGE-GCARRNR 261

  Fly   243 PSGYTRVSDYLEWI 256
            |..|.||:.:.:||
Mouse   262 PGVYIRVTSHHKWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 71/250 (28%)
Tryp_SPc 36..259 CDD:238113 72/251 (29%)
Prss27NP_780649.1 Tryp_SPc 37..275 CDD:214473 71/250 (28%)
Tryp_SPc 39..278 CDD:238113 72/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.