DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and try-3

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:264 Identity:67/264 - (25%)
Similarity:112/264 - (42%) Gaps:54/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCL----TGDYVEIHYGSN 95
            ||:.|....:| |.::..|....| :..|.:...|:|.:.|::|||||.    |..:|.:.... 
 Worm    37 RIIGGNSIDDG-ANWMAKLVSYGD-NGQGILCGATVIDDFWLVTAAHCALQLQTRSFVYVREPK- 98

  Fly    96 WGWNGAYRQTVRRDNFISHPDWPSQ-GGRDIGLIRTPHVDFNGLINKIPLPSMNEQND------R 153
               |...|....::.:| |..:.:| ...||.|:|     .:..::|:.:..:...:|      :
 Worm    99 ---NNRERSFSVKEAYI-HSGYNNQTADNDIALLR-----ISSDLSKLGIKPVCLVHDDSKLLKQ 154

  Fly   154 YQDTWCVACGWG---GMDNGN-----LADWLQCVDVQIISNSECEQAYGSVASTDMCTRHADGKS 210
            |::.  |..|:|   |.|:..     .:..||...|.|||:.:|.:.:..::   :.:....|..
 Worm   155 YKNG--VVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLS---LLSVKITGYQ 214

  Fly   211 VCG---------GDSGGPLVTH-DNARLVGV-ITFASVSCHDG-------PSGYTRVSDYLEWIR 257
            :|.         |||||||:.| .|...|.: ||.......||       |..|||:|.|:.||:
 Worm   215 ICAGAYLHGTAPGDSGGPLLIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWIQ 279

  Fly   258 DQTG 261
            ...|
 Worm   280 GVIG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 64/257 (25%)
Tryp_SPc 36..259 CDD:238113 65/259 (25%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 64/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.