DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CTRL

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:276 Identity:84/276 - (30%)
Similarity:130/276 - (47%) Gaps:41/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLLTLSAALALVAAS-----PTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNS 62
            :.||:|:.:|.|:.:|     | .:......||    |||||..|..|..|:.|.|   .|.|..
Human     1 MLLLSLTLSLVLLGSSWGCGIP-AIKPALSFSQ----RIVNGENAVLGSWPWQVSL---QDSSGF 57

  Fly    63 GAVGAGTIIANDWILTAAHC---------LTGDYVEIHYGSNWGWNGAYRQTVRRDNFISHPDWP 118
            ...| |::|:..|::|||||         :.|:|       :...|....|.:.....|:||.|.
Human    58 HFCG-GSLISQSWVVTAAHCNVSPGRHFVVLGEY-------DRSSNAEPLQVLSVSRAITHPSWN 114

  Fly   119 SQG-GRDIGLIR--TPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDN-GNLAD-WLQC 178
            |.. ..|:.|::  :| ..:...|:.:.|.|.||.  ..:...||..|||.:.. ||:.. .||.
Human   115 STTMNNDVTLLKLASP-AQYTTRISPVCLASSNEA--LTEGLTCVTTGWGRLSGVGNVTPAHLQQ 176

  Fly   179 VDVQIISNSECEQAYGSVASTDMCTRHADGKSVCGGDSGGPLVTHDNAR--LVGVITFASVSCH- 240
            |.:.:::.::|.|.:||..:..|......|.|.|.||||||||......  |:|::::.:.:|: 
Human   177 VALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNV 241

  Fly   241 DGPSGYTRVSDYLEWI 256
            ..|:.|||||.:..||
Human   242 RAPAVYTRVSKFSTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 73/237 (31%)
Tryp_SPc 36..259 CDD:238113 74/238 (31%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 74/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.