DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG43125

DIOPT Version :10

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:41 Identity:17/41 - (41%)
Similarity:24/41 - (58%) Gaps:5/41 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 APYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDY 87
            ||::|.  ||.:.| |.....||:|...::||||.|:  ||
  Fly    36 APWLVK--IRPELS-SNITCTGTLINERFVLTAASCI--DY 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 36..259 CDD:238113 17/41 (41%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:473915 16/40 (40%)

Return to query results.
Submit another query.