DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and Ctrl

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:276 Identity:84/276 - (30%)
Similarity:130/276 - (47%) Gaps:41/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLLTLSAALALVAAS-----PTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNS 62
            :.||:|:.:|.|:.:|     |.   .|..||...  |||||..|..|..|:.|.|...|.....
  Rat     1 MLLLSLTLSLVLLGSSWGCGVPA---ITPALSYNQ--RIVNGENAVPGSWPWQVSLQDNTGFHFC 60

  Fly    63 GAVGAGTIIANDWILTAAHC---------LTGDYVEIHYGSNWGWNGAYRQTVRRDNFISHPDW- 117
            |    |::||.:|::|||||         :.|:|       :...|....|.:.....|:||.| 
  Rat    61 G----GSLIAPNWVVTAAHCKVTPGRHFVILGEY-------DRSSNAEPIQVLSISKAITHPSWN 114

  Fly   118 PSQGGRDIGLIR--TPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDN-GNLAD-WLQC 178
            |:....|:.|::  :| ..:...::.:.|.|.||...  ....||..|||.:.. ||:.. .||.
  Rat   115 PNTMNNDLTLLKLASP-ARYTAQVSPVCLASSNEALP--AGLTCVTTGWGRISGVGNVTPARLQQ 176

  Fly   179 VDVQIISNSECEQAYGSVASTDMCTRHADGKSVCGGDSGGPLVTHDNAR--LVGVITFASVSCH- 240
            |.:.:::.::|.|.:||..:..|......|.|.|.||||||||......  |:|::::.:.:|: 
  Rat   177 VVLPLVTVNQCRQYWGSRITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTENCNV 241

  Fly   241 DGPSGYTRVSDYLEWI 256
            ..|:.|||||.:..||
  Rat   242 QAPAMYTRVSKFNTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 72/237 (30%)
Tryp_SPc 36..259 CDD:238113 73/238 (31%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 72/237 (30%)
Tryp_SPc 34..260 CDD:238113 73/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.