DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG42694

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:225 Identity:49/225 - (21%)
Similarity:86/225 - (38%) Gaps:65/225 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 AGTIIANDWILTAAHCLTGDYVEIHYGSNWGWNGAYRQTVRRDNFISHPDW--------PSQGG- 122
            :|::|:..::|:||.|     :::|        |.....:...|....|.|        ||..| 
  Fly    59 SGSLISKQFVLSAAQC-----IDVH--------GKLFVQLGVSNATKSPHWYTVSNVVIPSHSGK 110

  Fly   123 ---RDIGLIR-TPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMD------NGNLADWL- 176
               |||||:: :..||:|..:..|                |:|.....:|      |...:.|| 
  Fly   111 RLQRDIGLLKLSQSVDYNDFVYPI----------------CIALNTNTLDMVKILQNFTTSAWLS 159

  Fly   177 -----QCVDVQIISNSECE-QAYGSVASTDMCTRHADGKSVCGGDSGG----PLVTHDN---ARL 228
                 |.:.:..:|...|: ...|:|...::|.......:.|..|||.    |::...|   ..|
  Fly   160 KNKNPQTIVLSQLSRDRCKLNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREML 224

  Fly   229 VGVITFASVS--CHDGPSGYTRVSDYLEWI 256
            .|:..:.:..  |.: |:.|..|::.:.||
  Fly   225 FGIRGYVNGRSWCSE-PAIYIDVAECVGWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 47/223 (21%)
Tryp_SPc 36..259 CDD:238113 49/225 (22%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 49/225 (22%)
Tryp_SPc 46..253 CDD:214473 47/223 (21%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.