DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and LOC101733231

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_004913565.1 Gene:LOC101733231 / 101733231 -ID:- Length:263 Species:Xenopus tropicalis


Alignment Length:231 Identity:73/231 - (31%)
Similarity:108/231 - (46%) Gaps:16/231 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGS-NWGW 98
            |||||..|..|..|:.|.|    ..|.|.....|::|.|:|::|||||......::..|. :.|.
 Frog    33 RIVNGEEAVPGSWPWQVSL----QDSTSWHFCGGSLINNEWVVTAAHCGVSTRDKVVLGEHDRGS 93

  Fly    99 NGAYRQTVRRDNFISHPDWPSQG-GRDIGLIR--TPHVDFNGLINKIPLPSMNEQNDRYQDTWCV 160
            |....|::......:||.|.|.. ..||.||:  ||.| ....:  .|:...|..:|......||
 Frog    94 NVEKIQSLAVAKVFTHPQWNSNTINNDISLIKLATPAV-LGATV--APVCLANTGDDYEGGRICV 155

  Fly   161 ACGWG--GMDNGNLADWLQCVDVQIISNSECEQAYGSVASTDMCTRHADGKSVCGGDSGGPLV-- 221
            ..|||  ..:.....:.||...:.:::|.:|:..:|:..:..|....|.|.|.|.||||||||  
 Frog   156 TSGWGKTRYNAFTTPNQLQQTALPLLTNDQCKSYWGNNITGTMICAGAAGSSSCMGDSGGPLVCQ 220

  Fly   222 THDNARLVGVITFASVSCHDG-PSGYTRVSDYLEWI 256
            .:|...|||::::.|..|... |:.|.||:....|:
 Frog   221 ANDAWTLVGIVSWGSSMCSTSTPAVYARVAVLRSWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 72/229 (31%)
Tryp_SPc 36..259 CDD:238113 72/230 (31%)
LOC101733231XP_004913565.1 Tryp_SPc 33..256 CDD:214473 72/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.