DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and zgc:163079

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:255 Identity:68/255 - (26%)
Similarity:109/255 - (42%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVNGYPAPEGKAPYIVGLFIR-TDGSNSGAVGAGTIIANDWILTAAH---CLTGDYVEIHYGSN 95
            :|:.|..|.:|..|:...:.:: |:....|    |::|...|:||.|.   .:....:.::.|  
Zfish    35 KIIGGLNATQGSWPWQASINLKATEEFYCG----GSLINKGWVLTTAKVFALMPASDIVVYLG-- 93

  Fly    96 WGWNGAYRQTVRRDN----------FISHPDWPSQGGRDIGLIR-TPHVDFNGLINKIPLPSMNE 149
                   |||....|          .|.||::.|... ::.|:: :..|.|:..|..:.|.:...
Zfish    94 -------RQTQNGSNPYEISRTVTKIIKHPNYNSLDS-NLALLKLSSPVTFSDYIKPVCLAAAGS 150

  Fly   150 QNDRYQDTWCVACGWGGMDNG------NLADWLQCVDVQIISNSECEQAYGSVASTD-MCTRH-- 205
            .......:|  ..|||.::..      .|.|.||.|:..|::|.||..|||.:.:.. :|..:  
Zfish   151 VFVDGTASW--VTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECNAAYGGIITNKLLCAGYLN 213

  Fly   206 ADGKSVCGGDSGGPLVTHDNARLV--GVITFASVSCHDGPSGYTRVSDYLEWIRDQTGIS 263
            .|||:.|.||.|||||....|..:  ||:..........|:.|.|||:|.:||...|..|
Zfish   214 EDGKAPCAGDVGGPLVIKQGAIWIQSGVVVSGYCGLPGYPTIYVRVSEYEDWISYYTNSS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 64/246 (26%)
Tryp_SPc 36..259 CDD:238113 66/248 (27%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 64/246 (26%)
Tryp_SPc 36..267 CDD:238113 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.