DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and si:dkey-238d18.3

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001373176.1 Gene:si:dkey-238d18.3 / 795978 ZFINID:ZDB-GENE-131127-38 Length:272 Species:Danio rerio


Alignment Length:242 Identity:79/242 - (32%)
Similarity:113/242 - (46%) Gaps:29/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHC---LTTDYVE 93
            |.||    |:.|..|.  :.|:.|.  |:|  |:...:..|::|...|:||||||   ..:.||.
Zfish    40 IHEG----IMQGVDAL--RWPWQVS--IKT--SSGEHLCGGSLINKFWVLTAAHCQIQARSHYVV 94

  Fly    94 I--HYGSNWGWNGAFRQSVRRDNFISHP--NWPAEGGRDIGLIRTPS-VGFTDLINKVALPSFSE 153
            :  |..|:   |....|.......|:||  |.......|:.|::..| ...|.|::.|.|.|   
Zfish    95 LGQHDRSS---NDGTVQVKEIAKVITHPDNNIQTLFNNDVTLLKLSSPAQMTSLVSPVCLAS--- 153

  Fly   154 ESDRFV-DTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTVASTD-MCTRRTDGKSSC 216
            .|.:.| .|.||..|||.......|..||...:.|:|.|:|:|.:|....|: |......|.|||
Zfish   154 SSSKIVPGTLCVTTGWGRTKTELSARILQEATIPIVSQSQCKQIFGASKITNSMICAGGSGSSSC 218

  Fly   217 GGDSGGPLVTHDNA--RLVGVITFGSVDCH-SGPSGYTRVTDYLGWI 260
            .|||||||:...:.  ..||::::|:.||. ..|..|.||:.:..||
Zfish   219 QGDSGGPLMCESSGVWYQVGIVSWGNRDCRVDFPLVYARVSYFRKWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 74/233 (32%)
Tryp_SPc 40..263 CDD:238113 76/234 (32%)
si:dkey-238d18.3NP_001373176.1 Tryp_SPc 52..268 CDD:238113 73/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.