DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and ctrb.2

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001038747.1 Gene:ctrb.2 / 692313 ZFINID:ZDB-GENE-060519-7 Length:263 Species:Danio rerio


Alignment Length:267 Identity:83/267 - (31%)
Similarity:122/267 - (45%) Gaps:27/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTI 74
            :.||::..:.|....::.|.:|    ...|||||..|.....|:.|.|   .|.:.....| |::
Zfish     8 LCLALIGTAYGCGVPAIPPVIT----GYARIVNGEEAVPHSWPWQVSL---QDSTGFHFCG-GSL 64

  Fly    75 IASDWILTAAHC-LTTDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPA-EGGRDIGLIR--TP 135
            |...|::||||| :.|.:..|....:...|....|::.......|||:.. ....||.||:  ||
Zfish    65 INEWWVVTAAHCNVRTSHRVILGEHDRSSNAESIQTMTVGKVFKHPNFNMFTINNDILLIKLATP 129

  Fly   136 SVGFTDLINKVALP-SFSEESDRFVDTW-CVACGWGGMDNGNLAD---WLQCMDVQIISNSECEQ 195
            :     .||....| ..:|.:|.|.... ||..|| |:...|..|   .||...:.:::|.:|::
Zfish   130 A-----KINTHVSPVCLAETNDNFPGGMKCVTSGW-GLTKHNAPDTPALLQQAALPLLTNEDCKR 188

  Fly   196 SYGTVASTDMCTRRTDGKSSCGGDSGGPLVTHDNA--RLVGVITFGSVDCH-SGPSGYTRVTDYL 257
            .:|...:..|......|.|||.||||||||...:.  .|||::::||..|. |.|..|.|||...
Zfish   189 FWGNKITDLMVCAGASGASSCMGDSGGPLVCQKDGVWTLVGIVSWGSSVCSPSSPGVYARVTKLR 253

  Fly   258 GWIRDNT 264
            .|: |.|
Zfish   254 AWV-DQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 75/232 (32%)
Tryp_SPc 40..263 CDD:238113 75/234 (32%)
ctrb.2NP_001038747.1 Tryp_SPc 33..256 CDD:214473 75/232 (32%)
Tryp_SPc 34..259 CDD:238113 76/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.