DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and Tmprss11a

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_038948511.1 Gene:Tmprss11a / 686581 RGDID:1596322 Length:387 Species:Rattus norvegicus


Alignment Length:252 Identity:83/252 - (32%)
Similarity:121/252 - (48%) Gaps:43/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWN 103
            |||:|.||.:|..|:.|.|     ..|:.....||:|.:.|::|||||..|:      .:...|.
  Rat   155 RIVSGNPAAKGAWPWQVSL-----QRNNIHQCGGTLIGNMWVVTAAHCFRTN------ANPRQWT 208

  Fly   104 GAF---------RQSVRRDNFISHPNW-PAEGGRDIGLIR-TPSVGFTDLINKVALP----SFSE 153
            .:|         ::.|||  .|.|..: |.....||.|:: :|.|.|:|.:.::.||    ||..
  Rat   209 LSFGTTINPPLMKREVRR--IIMHEKYRPPARDHDIALVQFSPRVTFSDEVRRICLPEPSASFPP 271

  Fly   154 ESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQS--YGTVASTDM-CTRRTDG-KS 214
            .|..:: |...|..:||.....|.:    ..||||||..|:|.  ||......| |....:| ..
  Rat   272 NSTVYI-TGFGALYYGGESQNELRE----ARVQIISNDVCKQRHVYGNEIKRGMFCAGFLEGIYD 331

  Fly   215 SCGGDSGGPLVTHDNA---RLVGVITFGSVDC--HSGPSGYTRVTDYLGWIRDNTGI 266
            :|.||||||||..|:.   .|:|::::|. :|  .:.|..||:||.|..||...||:
  Rat   332 ACRGDSGGPLVVRDDKDTWYLIGIVSWGD-NCGQKNKPGVYTQVTYYRRWIASKTGL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 79/244 (32%)
Tryp_SPc 40..263 CDD:238113 80/246 (33%)
Tmprss11aXP_038948511.1 SEA 35..133 CDD:396113
Tryp_SPc 156..384 CDD:238113 80/246 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.