DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG34409

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:301 Identity:73/301 - (24%)
Similarity:126/301 - (41%) Gaps:52/301 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLLTLSVALAVVAASPGFNRTSLLP---QVTISEG--AEGRIVNGYPAPEGKAPYIVGLLIRTDG 63
            |..||:..:..:.||......|:.|   :.|...|  .|.|::.|..|..|:.|::..:..|...
  Fly   209 FTTTLATPIETIPASLSTTTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRS 273

  Fly    64 SNSAAVG-AGTIIASDWILTAAHCLTT-----DYVEIHYGSNWGWNGAFRQSVRRDNFISHPNW- 121
            |:..:.. :|::|:|:.|:|||||:..     :...:..||.   :||...::  :..|.|||: 
  Fly   274 SSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLGSQ---DGATPFAI--EQVIVHPNYD 333

  Fly   122 PAEGGRDIGLIRTPSVGFTDLINKVALPSFSEE---SDRFVDTWCVACGW--------GGMDNGN 175
            ..:...||.|:|..|...|  ...:.|| |:..   .:|.:....||.||        ..||..|
  Fly   334 QPKYANDIALLRINSTNGT--FTPICLP-FNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSN 395

  Fly   176 LADWLQCMDVQIISNSECEQSYGT----------VASTDMCTRRTDGKSSCGGDSGGPLV----- 225
            ....::.:.:.|::.:.|..:|.:          :....:|.:.......|.||||||.:     
  Fly   396 STAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTS 460

  Fly   226 ----THDNARLVGVITFGSVDC--HSGPSGYTRVTDYLGWI 260
                |.....::|::.||...|  .:.|..||.|:.:..||
  Fly   461 GVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 61/259 (24%)
Tryp_SPc 40..263 CDD:238113 62/260 (24%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 61/259 (24%)
Tryp_SPc 252..501 CDD:238113 60/256 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.