DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG34171

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:310 Identity:69/310 - (22%)
Similarity:105/310 - (33%) Gaps:107/310 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLLTLSVALAVVAASPGFNRTSLLPQ--VTISEGAEGRIVNGY--PAPEGKAPYIVGL----LIR 60
            :.|.|.:||             :||:  .||.       :|.|  |.....:.|:|.|    .|.
  Fly     5 YFLLLKIAL-------------VLPKNITTIK-------INHYHEPTYSHLSSYLVSLRTRKYIH 49

  Fly    61 TDGSNSAAVGAGTIIASDWILTAAHCLTTD---------------------------YVEIHYGS 98
            |.|.|...  .|.|:.:..:||:|||:|..                           .|:||   
  Fly    50 TPGDNHFC--TGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIH--- 109

  Fly    99 NWGWNGAFRQSVRRDNFISHPNWPAEGGRDIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWC 163
                           |.|.||.:......||.:|:...  :..|......|.....|...|...|
  Fly   110 ---------------NMIIHPYYHRNQHNDIAIIKLKR--YVKLDGHHLAPVVLGNSSLEVGNDC 157

  Fly   164 VACG---------WGG-----MDNGNLADWLQCMDVQ---IISNSECEQSYGTVASTDMCTRRTD 211
            ...|         :|.     :.|..|..:.:|:.|:   :.:..|.|..        :|.:.|:
  Fly   158 KTIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENEDL--------ICVKSTE 214

  Fly   212 GKSSCGGDSGGPLVTHDNARLVGVITFGSVDCHS-GPSGYTRVTDYLGWI 260
             |..|..|.||||..  :.:|.| |..||::|.| .|..::.|:.|..|:
  Fly   215 -KQMCTTDFGGPLFC--DGQLYG-IALGSINCSSPDPVFFSDVSFYNSWV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 60/271 (22%)
Tryp_SPc 40..263 CDD:238113 61/272 (22%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 58/264 (22%)
Tryp_SPc 38..263 CDD:304450 58/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471222
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.