DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and PRSS3

DIOPT Version :10

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001184026.3 Gene:PRSS3 / 5646 HGNCID:9486 Length:261 Species:Homo sapiens


Alignment Length:33 Identity:10/33 - (30%)
Similarity:15/33 - (45%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 DKRGDWRSKAYGWCARA-DDYNSQGSIAEYLSK 234
            |...|.:..|.....:| :.||.:..||.|:.|
Human    12 DMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKK 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 40..263 CDD:238113 10/33 (30%)
PRSS3NP_001184026.3 Tryp_SPc 38..256 CDD:238113 4/7 (57%)

Return to query results.
Submit another query.