DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and PROC

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC / 5624 HGNCID:9451 Length:576 Species:Homo sapiens


Alignment Length:249 Identity:65/249 - (26%)
Similarity:108/249 - (43%) Gaps:41/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTT---------DYVEI 94
            |:::|.....|.:|:.|.||   |.....|.|| .:|...|:||||||:..         :| ::
Human   326 RLIDGKMTRRGDSPWQVVLL---DSKKKLACGA-VLIHPSWVLTAAHCMDESKKLLVRLGEY-DL 385

  Fly    95 HYGSNWGWNGAFRQSVRRDNFISHPNW-PAEGGRDIGLIR--TPSVGFTDLINKVALP--SFSEE 154
            .....|..:...::.     |: |||: .:....||.|:.  .|:. .:..|..:.||  ..:|.
Human   386 RRWEKWELDLDIKEV-----FV-HPNYSKSTTDNDIALLHLAQPAT-LSQTIVPICLPDSGLAER 443

  Fly   155 SDRFVDTWCVACGWGGMDN------GNLADWLQCMDVQIISNSECEQSYGTVASTDMCTRRT--D 211
            .........:..|||...:      .|....|..:.:.::.::||.:....:.|.:|.....  |
Human   444 ELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGD 508

  Fly   212 GKSSCGGDSGGPLVT--HDNARLVGVITFGSVDC---HSGPSGYTRVTDYLGWI 260
            .:.:|.||||||:|.  |....|||::::|. .|   |: ...||:|:.||.||
Human   509 RQDACEGDSGGPMVASFHGTWFLVGLVSWGE-GCGLLHN-YGVYTKVSRYLDWI 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 63/247 (26%)
Tryp_SPc 40..263 CDD:238113 64/248 (26%)
PROCXP_024308770.1 GLA 117..168 CDD:214503
EGF_CA 182..213 CDD:238011
FXa_inhibition 255..290 CDD:317114
Tryp_SPc 328..563 CDD:238113 64/247 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.